DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and slc-25A10

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_509133.1 Gene:slc-25A10 / 180940 WormBaseID:WBGene00019656 Length:290 Species:Caenorhabditis elegans


Alignment Length:290 Identity:83/290 - (28%)
Similarity:145/290 - (50%) Gaps:31/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQL--QGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP 71
            ||||...|...|:|::::|.::|.  ||:|           ::.|..:.:.||||||....|::.
 Worm    15 GGVAGAMAACCTHPLDLLKVQLQTQQQGKL-----------TIGQLSLKIYKNDGILAFYNGVSA 68

  Fly    72 ALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGM---FWGALGGVVGSYCASPFFLIKTQL 133
            ::..|...::.|..|| ..|:| .:..::....:.|.:   |.||.||:||    :|..|:..::
 Worm    69 SVLRQLTYSTTRFGIY-ETVKK-QLPQDQPLPFYQKALLAGFAGACGGMVG----TPGDLVNVRM 127

  Fly   134 QAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLK 198
            |..:...:.....::||  .|.:.:|.|:.|...::.|:....|||.:.:..|::.:.|.|..|.
 Worm   128 QNDSKLPLEQRRNYKHA--LDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLI 190

  Fly   199 ENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSE 263
            .:||........|.|.::|.|..::...||||:.||:.|.   |.|.   ::|.|||.:...:. 
 Worm   191 SSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRMMNA---APGE---FKGILDCFMFTAKL- 248

  Fly   264 GVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293
            |..|.:|||.|.:.|.||::.|..:||::|
 Worm   249 GPMGFFKGFIPAWARLAPHTVLTFIFFEQL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 22/79 (28%)
PTZ00169 5..293 CDD:240302 82/288 (28%)
Mito_carr 101..201 CDD:278578 25/102 (25%)
Mito_carr 204..296 CDD:278578 30/90 (33%)
slc-25A10NP_509133.1 PTZ00169 3..279 CDD:240302 83/290 (29%)
Mito_carr 15..91 CDD:278578 26/88 (30%)
Mito_carr 95..193 CDD:278578 25/103 (24%)
Mito_carr 214..283 CDD:278578 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.