DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and slc25a34

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001135591.1 Gene:slc25a34 / 100216146 XenbaseID:XB-GENE-5994554 Length:301 Species:Xenopus tropicalis


Alignment Length:301 Identity:139/301 - (46%)
Similarity:189/301 - (62%) Gaps:11/301 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGL 69
            |||||..|...|.|||||:||:|||:||||||.:||::.:.|:.|.||.|.|.:.||:.||||||
 Frog     8 DFVLGASACCMACVFTNPLEVVKTRLQLQGELRSRGTYTRHYRGVLQAMVAVGQADGLRGLQKGL 72

  Fly    70 APALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQ 134
            ...|.:|.::|..|..:|:||...|......|.|:.      ||:.|..|::..||.:|:||.||
 Frog    73 TAGLLYQAMMNGVRFYLYSHAEGIGLTEQPGGNIAA------GAVAGATGAFVGSPAYLVKTHLQ 131

  Fly   135 AQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKE 199
            ||....||||:||.|.|:|.|...||:|.|:.|||||....|.|..|.||||:|.|..||..:|:
 Frog   132 AQTVAAIAVGHQHNHQSVSSAFETIYKKQGILGLWRGVNGAVPRVMVGSAVQLATFANAKEWVKK 196

  Fly   200 NGVVTHPT-ILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSE 263
            .....|.: :::...|:.:...|::|:||.|||:||||||.||:.|:|..|||:|||:|.|:..|
 Frog   197 QQWFPHDSWLVALTGGMISSIGVAIAMTPFDVVSTRLYNQPVDSSGKGRLYRGFLDCILKIIHKE 261

  Fly   264 GVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREKYDLHY 304
            ||..||||..|.|:|..|::.|.|||::||    .|:..:|
 Frog   262 GVLALYKGIVPAYIRLGPHTILSLLFWEEL----RKFTYYY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 43/81 (53%)
PTZ00169 5..293 CDD:240302 135/288 (47%)
Mito_carr 101..201 CDD:278578 46/99 (46%)
Mito_carr 204..296 CDD:278578 44/92 (48%)
slc25a34NP_001135591.1 Mito_carr 3..90 CDD:278578 43/81 (53%)
Mito_carr <118..196 CDD:278578 39/77 (51%)
Mito_carr 202..294 CDD:278578 44/95 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7192
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68806
Inparanoid 1 1.050 163 1.000 Inparanoid score I4090
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 1 1.000 - - FOG0001815
OrthoInspector 1 1.000 - - otm48081
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.