DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Slc25a14

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus


Alignment Length:289 Identity:91/289 - (31%)
Similarity:160/289 - (55%) Gaps:13/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGE-LAARGTYVEPYKGIVNAFITVAKNDGITGLQKGL 69
            ||.|||||:.|.|.|.|:::.|||:|:||: :..|...:: |:|:.:|...:.:.:||..|..|:
  Rat    63 FVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIK-YRGMFHALFRIYREEGILALYSGI 126

  Fly    70 APALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQ 134
            ||||..|....:.::.|| ::::|.::...:.|... :.::.|.:.||:....::|..::|.::|
  Rat   127 APALLRQASYGTIKIGIY-QSLKRLFVERLEDETLL-INMICGVVSGVISSTIANPTDVLKIRMQ 189

  Fly   135 SQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQ 199
            :|.:.     :|   .||..:...||.:.|.||||||.|....|||:..|.::..:..||..|:.
  Rat   190 AQGSL-----FQ---GSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIV 246

  Fly   200 YDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEG 264
            ..::....|..|.:....|...::|..|.||:.||:.||.. ..|...||:|.||..:|:.:.||
  Rat   247 SGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRA-IVGHVDLYKGTLDGILKMWKHEG 310

  Fly   265 VYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            .:.:|||||.|:||:.|.:.:..:.:::|
  Rat   311 FFALYKGFWPNWLRLGPWNIIFFITYEQL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 30/81 (37%)
PTZ00169 5..293 CDD:240302 90/287 (31%)
Mito_carr 101..200 CDD:278578 28/98 (29%)
Mito_carr 206..301 CDD:278578 30/88 (34%)
Slc25a14XP_006257593.1 PTZ00169 63..342 CDD:240302 91/289 (31%)
Mito_carr 253..342 CDD:395101 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.