DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Slc25a27

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:299 Identity:95/299 - (31%)
Similarity:155/299 - (51%) Gaps:40/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSDFVLGGLASVGATFFTNPIEVIKTRIQLQGE--LAARGTYV---EPYKGIVNAFITVAKNDGI 62
            ||.|:|.|.|:..|...|.|:::.|||:|:|||  ||..|...   .||:|::...:.:.:.:|.
  Rat    19 TSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMESAPYRGMMRTALGIVQEEGF 83

  Fly    63 TGLQKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMG-----LLW-----GAIGGV 117
            ..|.:|:.||:|...:.:..|:..|.        |.|  ||.:|..     .||     |.:.||
  Rat    84 LKLWQGVTPAIYRHVVYSGGRMVTYE--------HLR--EVVFGKSEDEHYPLWKSVIGGMMAGV 138

  Fly   118 VGCYFSSPFFLIKTQLQSQAAKQI---AVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRA 179
            :|.:.::|..|:|.|:|.:..:::   .:.::..|    .|..:|.:..|:||||.|.:..:.||
  Rat   139 IGQFLANPTDLVKVQMQMEGKRRLEGKPLRFRGVH----HAFAKILAEGGIRGLWAGWIPNIQRA 199

  Fly   180 ALGSGAQIATFGKTKALLV----QYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGV 240
            ||.:...:.|:...|..||    ..|.:....|:|..:||:|    |:..||.|||.:|:.||..
  Rat   200 ALVNMGDLTTYDTVKHYLVLNTALEDNIATHGLSSLCSGLVA----SILGTPADVIKSRIMNQPR 260

  Fly   241 DAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRI 279
            |.:||||||:...||.::.::.||...:||||..::||:
  Rat   261 DKQGRGLLYKSSTDCVIQAVQGEGFLSLYKGFLPSWLRM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 28/87 (32%)
PTZ00169 5..293 CDD:240302 93/297 (31%)
Mito_carr 101..200 CDD:278578 31/115 (27%)
Mito_carr 206..301 CDD:278578 31/74 (42%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 34/108 (31%)
Mito_carr 122..218 CDD:278578 26/99 (26%)
Mito_carr 224..311 CDD:278578 32/80 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.