DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and DIC1

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:71/291 - (24%)
Similarity:132/291 - (45%) Gaps:30/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAPAL 73
            ||.|.:.||..|:|:::.|.|:|     ||    ..|...:.....::..|:|:.||..||:.|:
Yeast    20 GGAAGIFATMVTHPLDLAKVRLQ-----AA----PMPKPTLFRMLESILANEGVVGLYSGLSAAV 75

  Fly    74 YFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGM--GLLWGAIGGVVGCYFSSPFFLIKTQLQSQ 136
            ..|....:.|...|....|......:...::|.:  .:..|||||:.|.:..    ::..::|:.
Yeast    76 LRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFAD----VVNIRMQND 136

  Fly   137 AAKQIAV--GYQHAHTSMTDALRQIYS-RNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLV 198
            :|.:.|.  .|::|    .|.:.:||. ..|::.|:.|....:.|..|.:.:|:.|:...|..||
Yeast   137 SALEAAKRRNYKNA----IDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLV 197

  Fly   199 -QYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRS 262
             :.|..........:|.|:||.:.:...:|.||:.||:.|...|       ::..|......:|.
Yeast   198 TKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGD-------HQPALKILADAVRK 255

  Fly   263 EGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            ||...|::|:..::.|:.|.:.|:....::|
Yeast   256 EGPSFMFRGWLPSFTRLGPFTMLIFFAIEQL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 22/77 (29%)
PTZ00169 5..293 CDD:240302 70/289 (24%)
Mito_carr 101..200 CDD:278578 25/104 (24%)
Mito_carr 206..301 CDD:278578 21/88 (24%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 23/82 (28%)
Mito_carr 100..200 CDD:395101 25/107 (23%)
Mito_carr 203..289 CDD:395101 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.