DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and UCP3

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_172866.1 Gene:UCP3 / 837973 AraportID:AT1G14140 Length:305 Species:Arabidopsis thaliana


Alignment Length:281 Identity:81/281 - (28%)
Similarity:142/281 - (50%) Gaps:19/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAP 71
            :|..|:::.|...|.||::.|||:||.|..:|.|.:.....|:|:   .:|:.:|:.||.|||:|
plant    17 LLASLSAMVAESVTFPIDLTKTRMQLHGSGSASGAHRIGAFGVVS---EIARKEGVIGLYKGLSP 78

  Fly    72 ALYFQFIINSFRLSIYS--EAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQ 134
            |:.........|:..|.  :.:..|...|....:......|.|...||:....:||..|:|.::|
plant    79 AIIRHLFYTPIRIIGYENLKGLIVRSETNNSESLPLATKALVGGFSGVIAQVVASPADLVKVRMQ 143

  Fly   135 SQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQ 199
            :. .:.::.|.:..::...:|..:|....||:|||:|.:..:.||.|.:..::|.:...|..::.
plant   144 AD-GRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGELACYDHAKHFVID 207

  Fly   200 ----YDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKIL 260
                .|.:...||.|..:||.:.|:.    .|.||:.||:.|||.:|     :||...||.||.:
plant   208 KKIAEDNIFAHTLASIMSGLASTSLS----CPADVVKTRMMNQGENA-----VYRNSYDCLVKTV 263

  Fly   261 RSEGVYGMYKGFWANYLRIAP 281
            :.||:..::|||:..:.|:.|
plant   264 KFEGIRALWKGFFPTWARLGP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 26/79 (33%)
PTZ00169 5..293 CDD:240302 81/281 (29%)
Mito_carr 101..200 CDD:278578 23/102 (23%)
Mito_carr 206..301 CDD:278578 28/76 (37%)
UCP3NP_172866.1 Mito_carr 9..104 CDD:395101 27/89 (30%)
Mito_carr 110..209 CDD:395101 23/99 (23%)
Mito_carr 212..299 CDD:395101 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.