DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and AT5G19760

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_197477.1 Gene:AT5G19760 / 832096 AraportID:AT5G19760 Length:298 Species:Arabidopsis thaliana


Alignment Length:324 Identity:87/324 - (26%)
Similarity:133/324 - (41%) Gaps:76/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQL-QGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGL 69
            ||.||.:.:.||....||::||.|||| ||..|:..|             .:.||:|:....|||
plant    18 FVNGGASGMLATCVIQPIDMIKVRIQLGQGSAASITT-------------NMLKNEGVGAFYKGL 69

  Fly    70 APAL-----YFQFIINSFR--------------LSIYSEAMERRWMHNRKGEVSYGMGLLWGAIG 115
            :..|     |....:.||:              |.:|.:|:               .||..||||
plant    70 SAGLLRQATYTTARLGSFKLLTAKAIESNDGKPLPLYQKAL---------------CGLTAGAIG 119

  Fly   116 GVVGCYFSSPFFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRA- 179
            ..||    ||..|  ..::.||...:.:..:..:|:...||.:|.:..||..||:|....:.|| 
plant   120 ACVG----SPADL--ALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVRAM 178

  Fly   180 ALGSGAQIATFGKTKALLVQYDLVTQPTLNSF---------SAGLIAGSIMSVAITPPDVITTRL 235
            ||..|           :|..||...:...::.         .|..::|...:....|.|.:.|::
plant   179 ALNMG-----------MLASYDQSAEYMRDNLGFGEMSTVVGASAVSGFCAAACSLPFDFVKTQI 232

  Fly   236 YNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTK 299
            .....||:|: ..|.|.|||.:|.|:..|....|.||....:|||||..:..:|.:::...:.|
plant   233 QKMQPDAQGK-YPYTGSLDCAMKTLKEGGPLKFYSGFPVYCVRIAPHVMMTWIFLNQITKFQKK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 29/100 (29%)
PTZ00169 5..293 CDD:240302 86/316 (27%)
Mito_carr 101..200 CDD:278578 28/99 (28%)
Mito_carr 206..301 CDD:278578 26/103 (25%)
AT5G19760NP_197477.1 Mito_carr 13..87 CDD:395101 26/81 (32%)
Mito_carr 101..199 CDD:395101 33/129 (26%)
Mito_carr 210..292 CDD:395101 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.