DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Slc25a27

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:291 Identity:90/291 - (30%)
Similarity:150/291 - (51%) Gaps:40/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TNPIEVIKTRIQLQGELA-AR----GTYVEPYKGIVNAFITVAKNDGITGLQKGLAPALYFQFII 79
            |.|:::.|||:|:|||.| ||    .....||:|:|...:.:.:.:|...|.:|:.||:|...:.
Mouse    50 TFPLDLTKTRLQMQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHVVY 114

  Fly    80 NSFRLSIYSEAMERRWMHNRKGEVSYGMG-----LLW-----GAIGGVVGCYFSSPFFLIKTQLQ 134
            :..|:..|.        |.|  ||.:|..     .||     |.:.||:|.:.::|..|:|.|:|
Mouse   115 SGGRMVTYE--------HLR--EVVFGKSEDKHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQ 169

  Fly   135 SQAAKQI---AVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKAL 196
            .:..:::   .:.::..|    .|..:|.:..|:||||.|.:..:.||||.:...:.|:...|..
Mouse   170 MEGKRRLEGKPLRFRGVH----HAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHY 230

  Fly   197 LV----QYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFV 257
            ||    ..|.::...|:|..:||:|    |:..||.|||.:|:.||..|.:||||||:...||.:
Mouse   231 LVLNTPLEDNISTHGLSSLCSGLVA----SILGTPADVIKSRIMNQPRDKQGRGLLYKSSADCLI 291

  Fly   258 KILRSEGVYGMYKGFWANYLRIAPHSTLVLL 288
            :.::.||...:||||..::||:.....::.|
Mouse   292 QAVQGEGFLSLYKGFLPSWLRMVKMGEVLFL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 23/71 (32%)
PTZ00169 5..293 CDD:240302 90/291 (31%)
Mito_carr 101..200 CDD:278578 31/115 (27%)
Mito_carr 206..301 CDD:278578 32/83 (39%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 28/90 (31%)
Mito_carr 138..232 CDD:365909 26/97 (27%)
Mito_carr 240..>314 CDD:365909 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.