DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Slc25a30

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:135/264 - (51%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLA 70
            ||.|||||:.|...|.||::.|||:|:||:..........|:|:::|.:.:.:.:|:..|..|:|
Mouse     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIA 73

  Fly    71 PALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQS 135
            ||:..|....:.::..|...  :|....|..:.:..:.::.|.:.||:....::|..::|.::|:
Mouse    74 PAMLRQASYGTIKIGTYQSL--KRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQA 136

  Fly   136 QAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLV-- 198
            |.:.        ....|.|:...||.:.|.||||:|......|||:..|.::..:..||..|:  
Mouse   137 QNSA--------VQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILS 193

  Fly   199 --QYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILR 261
              ..|.|....|:||:.||:.    ::|..|.||:.||:.||....:||...|:|.|||.:::..
Mouse   194 GLMGDTVATHFLSSFTCGLVG----ALASNPVDVVRTRMMNQRALRDGRCAGYKGTLDCLLQVSV 254

  Fly   262 SEGV 265
            |.|:
Mouse   255 SAGL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 27/80 (34%)
PTZ00169 5..293 CDD:240302 78/264 (30%)
Mito_carr 101..200 CDD:278578 24/102 (24%)
Mito_carr 206..301 CDD:278578 22/60 (37%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 28/88 (32%)
Mito_carr 105..191 CDD:365909 23/93 (25%)
Mito_carr 199..>259 CDD:365909 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.