DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and slc25a27

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001011241.1 Gene:slc25a27 / 496683 XenbaseID:XB-GENE-1005902 Length:319 Species:Xenopus tropicalis


Alignment Length:314 Identity:99/314 - (31%)
Similarity:160/314 - (50%) Gaps:43/314 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSDFVLGGLASVGATFFTNPIEVIKTRIQLQGELAAR-----GTYVEPYKGIVNAFITVAKNDGI 62
            ||.|:|...|:..|...|.|:::.|||:|:|||.|.:     |:.| ||:|:|.....:.:.:|:
 Frog    17 TSKFILSACAASVAELVTFPLDLTKTRLQIQGEAALKRHGEVGSAV-PYRGMVRTATGIVQEEGL 80

  Fly    63 TGLQKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMG---LLW-----GAIGGVVG 119
            ..|.:|..||:|...:.:..|:..|.        |.|...:..|.|   .||     |...|.:|
 Frog    81 LKLWQGATPAVYRHIVYSGVRMVAYE--------HIRDSVLGKGDGDTFPLWKSVVGGMTAGAIG 137

  Fly   120 CYFSSPFFLIKTQLQSQAAKQI------AVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPR 178
            .:|:||..|:|.|:|.:..:::      ..|..||..:       |.|:.|:||||.|.|..:.|
 Frog   138 QFFASPTDLVKVQMQMEGKRRLEGKPPRVRGVYHAFVT-------IVSKGGIRGLWAGWVPNVQR 195

  Fly   179 AALGSGAQIATFGKTKALLVQYDLVTQ----PTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQG 239
            |||.:...:.|:...|..|::...:..    .|::|..:|::|.::.    ||.|||.||:.||.
 Frog   196 AALVNMGDLTTYDMVKHFLLRNTPIKDNSLCHTISSICSGVVAATLG----TPADVIKTRIMNQP 256

  Fly   240 VDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            .|..||||||:...||.::.:|.||...:||||...::|:||.|.:..|.::::
 Frog   257 RDKHGRGLLYKSSTDCLIQAIRGEGFMSLYKGFMPTWMRMAPWSLVFWLTYEQI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 28/87 (32%)
PTZ00169 5..293 CDD:240302 97/310 (31%)
Mito_carr 101..200 CDD:278578 33/112 (29%)
Mito_carr 206..301 CDD:278578 34/88 (39%)
slc25a27NP_001011241.1 Mito_carr 18..114 CDD:365909 31/104 (30%)
Mito_carr 122..216 CDD:365909 31/100 (31%)
Mito_carr 223..313 CDD:365909 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.