DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and aralar1

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:295 Identity:91/295 - (30%)
Similarity:140/295 - (47%) Gaps:31/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLA-SVGATFFTNPIEVIKTRIQLQ------GELAARGTYVEPYKGIVNAFITVAKNDGIT 63
            |.||..| :|||| ...||:::|||:|.|      ||:|.|.::        :.|..|.:::|..
  Fly   358 FTLGSFAGAVGAT-VVYPIDLVKTRMQNQRAGSYIGEVAYRNSW--------DCFKKVVRHEGFM 413

  Fly    64 GLQKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFL 128
            ||.:||.|.|.......:.:|::  ..:.|..:.::||.:.....:|.|...|.....|::|..:
  Fly   414 GLYRGLLPQLMGVAPEKAIKLTV--NDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEI 476

  Fly   129 IKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKT 193
            :|.:|  |.|.:||.|.:....|:...|       |:.||::|:.|.|.|....|.....|:..|
  Fly   477 VKIRL--QVAGEIASGSKIRAWSVVREL-------GLFGLYKGARACLLRDVPFSAIYFPTYAHT 532

  Fly   194 KALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVK 258
            ||::...|....| |...:||.|||...:..:||.|||.|||  |.|...|: ..|.|..|...|
  Fly   533 KAMMADKDGYNHP-LTLLAAGAIAGVPAASLVTPADVIKTRL--QVVARSGQ-TTYTGVWDATKK 593

  Fly   259 ILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            |:..||....:||..|...|.:|...:.|:.::.|
  Fly   594 IMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELL 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 29/87 (33%)
PTZ00169 5..293 CDD:240302 90/293 (31%)
Mito_carr 101..200 CDD:278578 27/98 (28%)
Mito_carr 206..301 CDD:278578 32/88 (36%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 30/100 (30%)
PTZ00169 358..631 CDD:240302 91/295 (31%)
Mito_carr 449..539 CDD:278578 27/98 (28%)
Mito_carr 544..633 CDD:278578 32/89 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.