DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG7943

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:274 Identity:66/274 - (24%)
Similarity:105/274 - (38%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGLASVGATF----FTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGL 65
            :|..|    .||.|    .|.||..:..|..|.|            ..|.:||..: :::|:..|
  Fly    56 EFACG----CGAAFVNIAVTYPIYKMIFRQMLHG------------VPITSAFAQL-RHEGLGFL 103

  Fly    66 QKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIK 130
            .:|:.|.|..:.|..|....::...  ||::........||..:|...:.|...... .||..::
  Fly   104 YRGMLPPLAQKTISLSIMFGVFDGT--RRYLVEDYRLNDYGAKVLAAVVAGSAESIL-LPFERVQ 165

  Fly   131 TQLQSQAAKQIAVGYQHAHTSMT-DALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTK 194
            |.|        |....|.|.|.| :|.|.:.|.:|.|.|:||......|..|.:........:..
  Fly   166 TLL--------ADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEAS 222

  Fly   195 ALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQ-GVDAEGRGLLYRGWLDC-FV 257
            ..|.:...|:..|:..|.||.:.|:.:|....|.:||...|.:: |..:||      .|..| .:
  Fly   223 VRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEG------SWQACKRI 281

  Fly   258 KILRSEGVYGMYKG 271
            .:.|...:...|:|
  Fly   282 YVERDRRIGNFYRG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 21/85 (25%)
PTZ00169 5..293 CDD:240302 66/274 (24%)
Mito_carr 101..200 CDD:278578 24/99 (24%)
Mito_carr 206..301 CDD:278578 18/68 (26%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 23/98 (23%)
Mito_carr 141..229 CDD:278578 24/96 (25%)
Mito_carr 235..322 CDD:278578 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.