DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG1907

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:299 Identity:80/299 - (26%)
Similarity:151/299 - (50%) Gaps:16/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLA 70
            |:.|||:.:|||....|::::|||:|:.|    .|:..:.|:..::...|:...:|...|.:|:.
  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIG 81

  Fly    71 PALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGM--GLLWGAIGGVVGCYFSSPFFLIKTQL 133
            .||..|....:.||.:|:...:   :...|.:.|.|:  .:..|.|.|..|.:..:|..:...::
  Fly    82 AALLRQATYTTGRLGMYTYLND---LFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143

  Fly   134 QSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLV 198
            .|..  ::.|..:..:|::.:||.:|....|:..|||||:..:.||.:.:..|:|::.:.|....
  Fly   144 TSDG--RLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFR 206

  Fly   199 QYDLVTQPTLN-SFSAGLIAGSIMSVAITPPDVITTRLYN-QGVDAEGRGLLYRGWLDCFVKILR 261
            ...|..:..:. .|.|.:::|.:.::...|.|:..||:.| :.||.:..   |||..|..:::.|
  Fly   207 HGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPE---YRGTADVLLRVAR 268

  Fly   262 SEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKY 300
            .|||:.::|||...|.|:.||:.|..:..::|.....||
  Fly   269 QEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 24/80 (30%)
PTZ00169 5..293 CDD:240302 77/290 (27%)
Mito_carr 101..200 CDD:278578 24/100 (24%)
Mito_carr 206..301 CDD:278578 29/97 (30%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 25/94 (27%)
Mito_carr 118..207 CDD:278578 22/90 (24%)
Mito_carr 219..307 CDD:278578 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.