DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG4743

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:328 Identity:76/328 - (23%)
Similarity:111/328 - (33%) Gaps:118/328 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAP 71
            |.||:|.:.......||:.:|||  ||.||           |...|       .|..|:.|||||
  Fly    32 VAGGVAGMVVDIALFPIDTVKTR--LQSEL-----------GFWRA-------GGFRGIYKGLAP 76

  Fly    72 ---------ALYF-------QFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGC 120
                     ||:|       ||      ||..::..:..::|           :...:...|:.|
  Fly    77 AAAGSAPTAALFFCTYECGKQF------LSSVTQTKDSPYVH-----------MAAASAAEVLAC 124

  Fly   121 YFSSPFFLIKTQLQS-QAAKQIAVGYQHAHTSMTDALRQIYSRNGV-RGLWRGSVAALPRAALGS 183
            ....|..:.|.:.|: |..||          |....|.:.|...|: |||:||            
  Fly   125 LIRVPVEIAKQRSQTLQGNKQ----------SGLQILLRAYRTEGLKRGLYRG------------ 167

  Fly   184 GAQIATFGKTKALLVQYDLVTQPTLNSFS------------------AGLIAGSIMSVAITPPDV 230
                  ||.|....:.:.|:..|....|.                  .|.:||.|.:...||.||
  Fly   168 ------FGSTIMREIPFSLIQFPLWEYFKLQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDV 226

  Fly   231 ITTRL-------YNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLL 288
            :.||:       .|:...|  |.:|:..:|:        .|..|::.||....|.|.........
  Fly   227 VKTRIMLAERESLNRRRSA--RRILHGIYLE--------RGFSGLFAGFVPRVLWITLGGAFFFG 281

  Fly   289 FFD 291
            |:|
  Fly   282 FYD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 29/95 (31%)
PTZ00169 5..293 CDD:240302 76/328 (23%)
Mito_carr 101..200 CDD:278578 20/100 (20%)
Mito_carr 206..301 CDD:278578 25/111 (23%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 27/92 (29%)
PTZ00168 25..281 CDD:185494 74/323 (23%)
Mito_carr 199..291 CDD:278578 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.