DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG5805

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:332 Identity:81/332 - (24%)
Similarity:132/332 - (39%) Gaps:66/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSDFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQK 67
            |..|.|..|:|........|:.||||::|:|.:       .:.|||:|:..:.:.:::|:.||.:
  Fly    40 TKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHK-------SDVYKGMVDCAMKIYRSEGVPGLYR 97

  Fly    68 GLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQ 132
            |...: ..|.:...|.:|.|...   |.:.|..|.......|..|....:||.....||.:|   
  Fly    98 GFWIS-SVQIVSGVFYISTYEGV---RHVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVI--- 155

  Fly   133 LQSQAAKQIAV-------------------GYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPR 178
              ||.|..:.:                   |....|.|| |..|:|..|:|.||.:||..|:|..
  Fly   156 --SQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISM-DIGREIMRRDGFRGFYRGYTASLMA 217

  Fly   179 AALGSGAQIATFGKTKALLVQYDL-------VTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLY 236
            ....|....|.:.     |.|.:|       |:...:... ||.:.|...::...|.|::..||.
  Fly   218 YVPNSAMWWAFYH-----LYQDELFRICPVWVSHLFIQCV-AGSLGGFTTTILTNPLDIVRARLQ 276

  Fly   237 NQGVDAEG---RGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL--VAV 296
            ...:|:..   |.|.....|:||            :||..|..::.|..|..::|.::.:  :||
  Fly   277 VHRLDSMSVAFRELWQEEKLNCF------------FKGLSARLVQSAAFSFSIILGYETIKRIAV 329

  Fly   297 RTKYSNQ 303
            ..:|.:|
  Fly   330 DEQYKHQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 22/82 (27%)
PTZ00169 5..293 CDD:240302 76/316 (24%)
Mito_carr 101..200 CDD:278578 29/117 (25%)
Mito_carr 206..301 CDD:278578 21/99 (21%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 22/89 (25%)
Mito_carr 132..238 CDD:395101 30/116 (26%)
Mito_carr 245..327 CDD:395101 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.