DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and DPCoAC

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:292 Identity:69/292 - (23%)
Similarity:118/292 - (40%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG--- 68
            :.|..|...|.....|::..|...|::.::..  ::....:.:.|.:    .|:|:..|.:|   
  Fly    77 ISGAAAGALAKTVIAPLDRTKINFQIRNDVPF--SFRASLRYLQNTY----ANEGVLALWRGNSA 135

  Fly    69 ----LAPALYFQFIINSFRLSIYSEAMERRWMH-NRKGEVSYGMGLLWGAIGGVVGCYFSSPFFL 128
                :.|....||.         :....||.:| ::.|..:.|...|.|::.|:.....:.|..|
  Fly   136 TMARIVPYAAIQFT---------AHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDL 191

  Fly   129 IKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGV--------RGLWRGSVAALPRAALGSGA 185
            .:.::   |......||:        .|||::::..|        ||.|...:..:|.|    |.
  Fly   192 ARARM---AVTDRYTGYR--------TLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYA----GT 241

  Fly   186 QIATFGKTKALLVQYDLV--TQP-TLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGL 247
            ...|:...|.  ..|::|  .:| ||.|.:.|..||:....|..|.|::..|:....|:..| |.
  Fly   242 SFFTYETLKR--EYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAG-GD 303

  Fly   248 LYRGWLDCFVKILRSEGV-YGMYKGFWANYLR 278
            .|...|:..|||.|.||| .|.|||...|:::
  Fly   304 RYPTILETLVKIYREEGVKNGFYKGLSMNWIK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 14/86 (16%)
PTZ00169 5..293 CDD:240302 69/292 (24%)
Mito_carr 101..200 CDD:278578 22/106 (21%)
Mito_carr 206..301 CDD:278578 28/75 (37%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 16/96 (17%)
Mito_carr 169..251 CDD:278578 20/96 (21%)
Mito_carr 279..356 CDD:278578 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.