DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Dic1

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:303 Identity:80/303 - (26%)
Similarity:143/303 - (47%) Gaps:40/303 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGLASVGATFFTNPIEVIKTRIQL-QGELAARGTYVEPYKGIVNAFITVAKNDGITGLQK 67
            |.:..||||||||...|:|:::||..:|. ||.|:           :......:|:..|:.....
  Fly     8 SMWFFGGLASVGAAMVTHPLDLIKVTLQTQQGHLS-----------VAQLIPKLAREQGVLVFYN 61

  Fly    68 GLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQ 132
            ||:.::..|...::.|..:|...  :::::.........:....|.:||:||    :|..::..:
  Fly    62 GLSASVLRQLTYSTARFGVYEAG--KKYVNTDSFGGKVALAGASGLVGGIVG----TPADMVNVR 120

  Fly   133 LQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALL 197
            :|:..  ::....:..:.:..|.|.::|.:.|.:.|:.|:.||..|..|.:..|||.:.:||..|
  Fly   121 MQNDV--KLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYL 183

  Fly   198 V-----QYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFV 257
            :     |.:|||.     |:|.|:||:|.:....|.||:.||..| ....|..||    |  ..|
  Fly   184 LATPYFQDNLVTH-----FTASLVAGTIATTLTQPLDVLKTRSMN-AKPGEFNGL----W--DIV 236

  Fly   258 KILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKY 300
            |.....|..|.:||:...::|:.||:.:..:|.::|   |.|:
  Fly   237 KHTAKLGPLGFFKGYVPAFVRLGPHTIITFVFLEQL---RLKF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 23/83 (28%)
PTZ00169 5..293 CDD:240302 76/293 (26%)
Mito_carr 101..200 CDD:278578 23/103 (22%)
Mito_carr 206..301 CDD:278578 29/95 (31%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/94 (24%)
PTZ00169 13..273 CDD:240302 77/293 (26%)
Mito_carr 89..184 CDD:278578 22/100 (22%)
Mito_carr 189..278 CDD:278578 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.