DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and GC2

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:335 Identity:74/335 - (22%)
Similarity:130/335 - (38%) Gaps:88/335 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQ-----GELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG 68
            ||:|.:.......|::::|||:|.|     ||        ..|..|.:.|.....::|..|:.:|
  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQTIGPNGE--------RMYTSIADCFRKTIASEGYFGMYRG 83

  Fly    69 -------LAPALYFQFIINS-FRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSP 125
                   :.|....:...|. ||..:.|:          .|.:......|.|.:.|:.....::|
  Fly    84 SAVNIVLITPEKAIKLTANDFFRYHLASD----------DGVIPLSRATLAGGLAGLFQIVVTTP 138

  Fly   126 FFLIKTQLQSQ---AAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAAL----------- 176
            ..|:|.|:|..   ||...|.|.:....:.....:.:....|:.||::| |.|.           
  Fly   139 MELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKG-VGATGVRDITFSMVY 202

  Fly   177 -----------PRAALGSGAQIATFGKTKALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDV 230
                       ||.:.|||..:..:                   |..|||::|...:..:||.||
  Fly   203 FPLMAWINDQGPRKSDGSGEAVFYW-------------------SLIAGLLSGMTSAFMVTPFDV 248

  Fly   231 ITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFF----- 290
            :.|||.   .|.|.:   ::|.:||..:.|:.||:...:||.....:.:||...:..:|:     
  Fly   249 VKTRLQ---ADGEKK---FKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFYFLGVG 307

  Fly   291 DELVAV-RTK 299
            ::::.: |||
  Fly   308 EKILGIERTK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 21/90 (23%)
PTZ00169 5..293 CDD:240302 71/326 (22%)
Mito_carr 101..200 CDD:278578 24/123 (20%)
Mito_carr 206..301 CDD:278578 28/100 (28%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 68/305 (22%)
Mito_carr 16..106 CDD:278578 19/86 (22%)
Mito_carr 123..203 CDD:278578 18/80 (23%)
Mito_carr 228..302 CDD:278578 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.