DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and slc25a30

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001165746.1 Gene:slc25a30 / 394840 XenbaseID:XB-GENE-995074 Length:291 Species:Xenopus tropicalis


Alignment Length:289 Identity:87/289 - (30%)
Similarity:154/289 - (53%) Gaps:12/289 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVE-PYKGIVNAFITVAKNDGITGLQKGL 69
            |:.|||||:.|...|.||::.|||:|:||: |....|.| .|:|:::|.:.:.|.:|:..|..|:
 Frog     9 FIYGGLASITAECGTFPIDLTKTRLQVQGQ-ANDAKYKEIRYRGMLHAIVRIWKEEGVKALYSGI 72

  Fly    70 APALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQ 134
            |||:..|....:.::..| ::::|.::...:.| :..:.:..|.:.|||....::|..::|.::|
 Frog    73 APAMLRQASYGTIKIGTY-QSLKRLFVDCPEDE-TLVINVFCGVLSGVVSSCIANPTDVLKIRMQ 135

  Fly   135 SQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQ 199
            :|.:  :..|      .|......||.:.|.||||:|......|||:..|.::..:..||..|:.
 Frog   136 AQGS--LIQG------GMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLIL 192

  Fly   200 YDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEG 264
            ..|:.......|.|....|...::|..|.||:.||:.||..........|:|.|||.::..::||
 Frog   193 SGLMGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSIRNVSNSSYKGTLDCLLQTWKNEG 257

  Fly   265 VYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            .:.:|||||.|:||:.|.:.:..:.:::|
 Frog   258 FFALYKGFWPNWLRLGPWNIIFFITYEQL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 30/81 (37%)
PTZ00169 5..293 CDD:240302 86/287 (30%)
Mito_carr 101..200 CDD:278578 26/98 (27%)
Mito_carr 206..301 CDD:278578 28/88 (32%)
slc25a30NP_001165746.1 Solcar 1 7..96 31/88 (35%)
PTZ00169 9..289 CDD:240302 87/289 (30%)
Solcar 2 104..189 25/93 (27%)
Solcar 3 198..289 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.