DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and slc25a27

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:309 Identity:97/309 - (31%)
Similarity:159/309 - (51%) Gaps:35/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGLASVGATFFTNPIEVIKTRIQLQGE--LAARGTYV--EPYKGIVNAFITVAKNDGITG 64
            |.|.|...|:..|...|.|:::.|||:|:|||  ....|..|  :.|:|:::....:.:.:|...
Zfish    14 SKFTLSACAAAVAELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLSTAAGIVREEGPLK 78

  Fly    65 LQKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGA-----IGGVVGCYFSS 124
            |.:|:.||:|...:.:..|:..|.:..|     :..|:...|:..:|.|     |.|.:|.:.:|
Zfish    79 LWQGVTPAIYRHIVYSGGRMLAYEQMRE-----SVLGKSEDGIFPVWKAVIASMISGALGQFIAS 138

  Fly   125 PFFLIKTQLQSQAAKQI------AVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGS 183
            |..|:|.|:|.:..:::      ..|..||.|       :|.::.|:||||.|.|..:.||||.:
Zfish   139 PTDLVKVQMQMEGRRRLEGKPPRVRGVYHAFT-------KIVAQGGIRGLWAGWVPNVQRAALVN 196

  Fly   184 GAQIATFGKTKALLVQYDLVTQPT----LNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEG 244
            ...:.|:...|..|::...:...:    |:|..:||:|.::.    ||.||:.||:.||..|:.|
Zfish   197 LGDLMTYDTVKHFLLRNTSIPDNSICHGLSSICSGLVAATMG----TPADVVKTRVMNQPRDSNG 257

  Fly   245 RGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            ||||||...||.|:.:|.||.:.:||||...:.|:||.|....|.|::|
Zfish   258 RGLLYRNSTDCLVQSVRREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 25/86 (29%)
PTZ00169 5..293 CDD:240302 95/306 (31%)
Mito_carr 101..200 CDD:278578 32/109 (29%)
Mito_carr 206..301 CDD:278578 38/92 (41%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 28/102 (27%)
PTZ00169 16..310 CDD:240302 96/307 (31%)
Mito_carr 118..213 CDD:278578 30/101 (30%)
Mito_carr 217..311 CDD:278578 38/94 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.