DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and slc25a14

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:291 Identity:89/291 - (30%)
Similarity:157/291 - (53%) Gaps:21/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGE---LAARGTYVEPYKGIVNAFITVAKNDGITGLQK 67
            ||.||:||:.|.|.|.||::.|||:|:||:   :..|      |:|:.:|.:.:.:.:|:..|..
Zfish    58 FVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVR------YRGMFHALLRIGREEGVRALYS 116

  Fly    68 GLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQ 132
            |::|||..|....:.::..|: .:::.::.:.:.|... :.:..|.:.||:....::|..::|.:
Zfish   117 GISPALLRQASYGTIKIGTYN-TLKKLFVSHPEEETMV-INVFCGVVSGVLSSSLANPTDVLKIR 179

  Fly   133 LQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALL 197
            :|:|.:  :..|      ||......||...|.||||||.:....|||:..|.::..:..||..|
Zfish   180 MQAQGS--LLQG------SMMSNFMNIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHL 236

  Fly   198 VQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRS 262
            ::..|:....|..|.:....|...::|..|.||:.||:.||.|.|...  ||:|.||..::..|:
Zfish   237 IRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNP--LYKGTLDGLMQTWRN 299

  Fly   263 EGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            ||.:.:|||||.|:||:.|.:.:..:.|::|
Zfish   300 EGFFALYKGFWPNWLRLGPWNIIFFMTFEQL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 28/83 (34%)
PTZ00169 5..293 CDD:240302 88/289 (30%)
Mito_carr 101..200 CDD:278578 27/98 (28%)
Mito_carr 206..301 CDD:278578 32/88 (36%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.