DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG7514

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:298 Identity:81/298 - (27%)
Similarity:143/298 - (47%) Gaps:39/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLA 70
            ::.||||.:..|....|::::|||:|:.   |..|    .||...:..:.|.||:||..|..||:
  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQIS---ATTG----EYKSSFDCLLKVFKNEGILALYNGLS 73

  Fly    71 PALYFQFIINSFRLSIYSEAMER-RWMHNRKGEV--SYGMGLLWGAIGGVVGCYFSSPFFLIKTQ 132
            ..|..|....:.|:..|...::. |...|....|  |.|||:|.||.|.:    |.:|..:...:
  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAM----FGNPAEVALIR 134

  Fly   133 LQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALL 197
            :.|.  .::....:..:|.:.:|..:|....||..||:|.:..:.||.:.:..|:|::.:.||..
  Fly   135 MMSD--NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF 197

  Fly   198 VQYDLVTQPTLNSFS-------AGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDC 255
            .:|          ||       |.:::|.:.::|..|.|:..||:..|.. ||     |:|.:|.
  Fly   198 SEY----------FSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKT-AE-----YKGTMDV 246

  Fly   256 FVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            .:|:.::||:..::|||.....|:.||:....:|.::|
  Fly   247 LMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 25/80 (31%)
PTZ00169 5..293 CDD:240302 80/296 (27%)
Mito_carr 101..200 CDD:278578 26/100 (26%)
Mito_carr 206..301 CDD:278578 26/95 (27%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 81/298 (27%)
Mito_carr 19..90 CDD:278578 25/77 (32%)
Mito_carr 104..201 CDD:278578 27/112 (24%)
Mito_carr 207..284 CDD:278578 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.