DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and PMP34

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:300 Identity:59/300 - (19%)
Similarity:138/300 - (46%) Gaps:36/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAPAL 73
            ||..:: :||:  |::.:::|:||:.....|.|     :.::...:.   .:|...|.:||.|.|
  Fly    25 GGCIAM-STFY--PLDTVRSRLQLEEAGDVRST-----RQVIKEIVL---GEGFQSLYRGLGPVL 78

  Fly    74 YFQFIINSFRLSIYSEAMERRWMHNRKGEVSYG--------MGLLWGAIGGVVGCYFSSPFFLIK 130
            . ...|::| :..|:       .|..|...|.|        ..||.|:|.|::....::||:::.
  Fly    79 Q-SLCISNF-VYFYT-------FHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVN 134

  Fly   131 TQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKA 195
            |:|:.:.....:......:.::.:.|:.:..:.|:.|||.|::.:|...: ....|...:...|.
  Fly   135 TRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVS-NPALQFMMYEMLKR 198

  Fly   196 LLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRG-------WL 253
            .::::......:|:.|..|.||.:..:|...|..::.|:..::..:::.:.....|       .|
  Fly   199 NIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTL 263

  Fly   254 DCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            :..:.||:.:|:.|:::|..|..|:....:.|:.:.::::
  Fly   264 ELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 18/77 (23%)
PTZ00169 5..293 CDD:240302 59/298 (20%)
Mito_carr 101..200 CDD:278578 20/106 (19%)
Mito_carr 206..301 CDD:278578 18/94 (19%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 20/90 (22%)
Mito_carr 105..202 CDD:278578 18/97 (19%)
Mito_carr 214..303 CDD:278578 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.