DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Tpc2

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:315 Identity:72/315 - (22%)
Similarity:124/315 - (39%) Gaps:62/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEP--------YKGIVNAFITVAKNDGITGL 65
            ||:|.......|.|::|:|.|.|:|         |||        |:|:::||.:|...:|:.|:
  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQ---------VEPVTNHKGSKYRGVIHAFKSVYAEEGMRGM 71

  Fly    66 QKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYG----------MGLLWGAIGGVVGC 120
            .:|          .||.::...|.|:.:.|.:.:...:::.          |..:.|.|.|.:|.
  Fly    72 FRG----------HNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGA 126

  Fly   121 YFSSPFFLIKTQLQSQAAKQIAVGYQHAHTSMT--DALRQIYSRNGVRGLWRGSVAALPRAALGS 183
            ..:.||.:::||:       :|.......:.|.  ..||::|...|..||.||....|.:.....
  Fly   127 VAAQPFDVVRTQM-------VAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLV 184

  Fly   184 GAQIATFGKTKALLVQYDLVTQPTLNS--------FSAGLIAGSIMSVAITPPDVITTRL----Y 236
            ||....:....|.:    |:.:|....        |..|.::|.:..:.:.|.|::..|:    :
  Fly   185 GANFLFYKYLNAAV----LMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAF 245

  Fly   237 NQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFD 291
            .|.....||.......|.|.....|.||:.|.|||.....|:....|.:....:|
  Fly   246 KQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 23/85 (27%)
PTZ00169 5..293 CDD:240302 72/315 (23%)
Mito_carr 101..200 CDD:278578 23/110 (21%)
Mito_carr 206..301 CDD:278578 22/98 (22%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 69/308 (22%)
Mito_carr 23..99 CDD:278578 23/94 (24%)
Mito_carr 108..194 CDD:278578 22/92 (24%)
Mito_carr 216..307 CDD:278578 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.