DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Tyler

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:383 Identity:90/383 - (23%)
Similarity:145/383 - (37%) Gaps:114/383 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGT-----YV----------------------- 43
            ::|||.:   ||...|:||:|||:|.|..:..|.|     ||                       
  Fly    53 LVGGLIT---TFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRD 114

  Fly    44 ----EPYKGIVNAFITVAKNDGITGLQKGLAPAL---------YF---QFIINSF-RLSIYSEAM 91
                .|.:|.::||:.:....|.:||..||:|.|         ||   ::|.||. .:.:.|:..
  Fly   115 PQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKF 179

  Fly    92 ERRWMHNR--------------------------KGEVSYGMGLLWGAIGGVVGCYFSSPFFLIK 130
            |...|.::                          ...:.|.:.:..|.....:.....:|..:::
  Fly   180 EESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVR 244

  Fly   131 TQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKA 195
            .::||:        |. .:..:...||.:..::|:.|||||....:.|.|..||...|.:...|.
  Fly   245 IKMQSE--------YM-TYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKR 300

  Fly   196 LLVQYDLVTQPT-LNSFSAGLIAGSIMSVAITPPDVITTR---------LYNQ---GVDA-EGRG 246
            ..    .||:|| |.||..|.|:|::.:....|.|:|||.         ||.:   |..| .|.|
  Fly   301 AF----SVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTG 361

  Fly   247 LLYR-------------GWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFD 291
            ...|             ..|....:|.|.:||.|:|.|.....||:.|...:::..|:
  Fly   362 AGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 33/124 (27%)
PTZ00169 5..293 CDD:240302 90/383 (23%)
Mito_carr 101..200 CDD:278578 20/98 (20%)
Mito_carr 206..301 CDD:278578 32/113 (28%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 33/120 (28%)
Mito_carr 216..302 CDD:278578 20/94 (21%)
Mito_carr 306..429 CDD:278578 32/114 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.