DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG8026

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:303 Identity:85/303 - (28%)
Similarity:133/303 - (43%) Gaps:46/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAP 71
            |.||:.|   |...:|:::||.|..:..   .|...|..|:|:.:||.|:.:.:|..||.||:.|
  Fly    30 VSGGVVS---TLILHPLDLIKIRFAVND---GRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTP 88

  Fly    72 ---------ALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFF 127
                     .|||.| .|:.:..|..        .|....:...|.:|..|..|::....::|.:
  Fly    89 NVWGSGSSWGLYFMF-YNTIKTFIQG--------GNTTMPLGPTMNMLAAAESGILTLLLTNPIW 144

  Fly   128 LIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGK 192
            ::||:|..|.....:..|:    .|..||.|||...|:|||:||.|..:...:.|: .|..|:.:
  Fly   145 VVKTRLCLQCDAASSAEYR----GMIHALGQIYKEEGIRGLYRGFVPGMLGVSHGA-IQFMTYEE 204

  Fly   193 TKALLVQY-------DLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYR 250
            .|....:|       .|.|...| :|:|  ::..|.:.|..|..|:..||.    |...|   |.
  Fly   205 LKNAYNEYRKLPIDTKLATTEYL-AFAA--VSKLIAAAATYPYQVVRARLQ----DHHHR---YN 259

  Fly   251 GWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            |..||..:..|.||..|.|||..|:..|:.|...:..|.::.:
  Fly   260 GTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 27/88 (31%)
PTZ00169 5..293 CDD:240302 85/301 (28%)
Mito_carr 101..200 CDD:278578 27/98 (28%)
Mito_carr 206..301 CDD:278578 26/88 (30%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 82/286 (29%)
Mito_carr 23..115 CDD:278578 28/99 (28%)
Mito_carr 119..213 CDD:278578 27/98 (28%)
Mito_carr 220..307 CDD:278578 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.