DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Dic3

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:297 Identity:80/297 - (26%)
Similarity:131/297 - (44%) Gaps:49/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAPAL 73
            ||:.:..|...|:||::||.::|.|.: |.|.|..|..|||       .:..||.|...|::.:.
  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQ-ADRKTVGEILKGI-------HERSGILGFYNGISASW 71

  Fly    74 YFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQS--Q 136
            :.|....:.|.::|....:  ::..:|......:....|.:||:||.    |..::..:||:  :
  Fly    72 FRQLTYTTTRFALYEAGKD--YVDTQKVSSKMALATFAGIVGGIVGV----PGDVVTVRLQNDVK 130

  Fly   137 AAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQYD 201
            ..::....|:|    :.|.|.:||...||..|:||:|.|:.||.|      .|.|...|    ||
  Fly   131 LPEEKRRNYKH----VFDGLFRIYKEEGVSSLFRGTVPAVSRAVL------LTIGTNAA----YD 181

  Fly   202 LVTQPTLNSFSAG----------LIAGSIMSVAITPPDVITTRLYN-QGVDAEGRGLLYRGWLDC 255
            .|.|....:..||          .|||.|..|...|.|||.|...| |..:..|.|       ..
  Fly   182 QVKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIG-------GA 239

  Fly   256 FVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDE 292
            |:...: :|....||||....:|::|::.:..:.:::
  Fly   240 FLSTAK-QGPLAFYKGFIPALIRVSPNTIITFVLYEQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 23/77 (30%)
PTZ00169 5..293 CDD:240302 80/297 (27%)
Mito_carr 101..200 CDD:278578 27/100 (27%)
Mito_carr 206..301 CDD:278578 24/98 (24%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 80/295 (27%)
Mito_carr 15..91 CDD:278578 24/85 (28%)
Mito_carr 93..187 CDD:278578 32/111 (29%)
Mito_carr 200..281 CDD:278578 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.