DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG4995

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:281 Identity:71/281 - (25%)
Similarity:120/281 - (42%) Gaps:31/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEP----YKGIVNAFITVAKNDGITGL 65
            |||.|.|.........:|.:.:|..:|..          :|    |||..:.|.|:.:.|...||
  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTD----------DPRNPKYKGTFHCFRTIVQRDKFIGL 97

  Fly    66 QKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIK 130
            .:|::..:....::|:....:|...  :|..::.....|:   ...|:|.||...:..:|..|.|
  Fly    98 YRGISSPMGGIGLVNAIVFGVYGNV--QRLSNDPNSLTSH---FFAGSIAGVAQGFVCAPMELAK 157

  Fly   131 TQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKA 195
            |:|  |.:.|:..|.:  .|.....|:.|....|:||.::|..|.:.|...|..:...:|   :.
  Fly   158 TRL--QLSTQVDSGIK--FTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSF---EY 215

  Fly   196 LLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKIL 260
            |:.|.:  |.....:..||..||....:|..|.||:.|.:.   .||.|....|.|::||.:|..
  Fly   216 LMRQVE--TPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQ---ADALGANAKYNGFIDCAMKGF 275

  Fly   261 RSEGVYGMYKGFWANYLRIAP 281
            |:||....::|..:..:|..|
  Fly   276 RNEGPQYFFRGLNSTLIRAFP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 19/85 (22%)
PTZ00169 5..293 CDD:240302 71/281 (25%)
Mito_carr 101..200 CDD:278578 25/98 (26%)
Mito_carr 206..301 CDD:278578 23/76 (30%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 20/93 (22%)
PTZ00169 41..295 CDD:240302 70/278 (25%)
Mito_carr 128..218 CDD:278578 25/99 (25%)
Mito_carr 221..304 CDD:278578 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.