DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Ucp4B

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:275 Identity:79/275 - (28%)
Similarity:148/275 - (53%) Gaps:5/275 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLAPALYFQFIINSFRLSI 86
            |.::.|||:|:|||:|:|......|:|::...:.:.:.:|:..|..|::..|:...:.:..::..
  Fly    56 PFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLT 120

  Fly    87 YSEAMERRWMHNRKG--EVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQSQAAKQIAVGYQHAH 149
            |....|:..:.:..|  ::|:....:.|.:.|......::|..|||.|:|.:..:::.......|
  Fly   121 YDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIH 185

  Fly   150 TSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLV-QYDLVTQPTLNSFSA 213
             ::..||..||...||.|||:|:|....|:||.:...::.:...|..|: ::|||....: .|.|
  Fly   186 -NVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREV-QFVA 248

  Fly   214 GLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLR 278
            .:.||...::...|.||:.:|:.||..|.:|||:.|:|.|||..:::|.||...|||||...::|
  Fly   249 AMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMR 313

  Fly   279 IAPHSTLVLLFFDEL 293
            :.|.|.:..:.|:::
  Fly   314 VGPASVVFWMTFEQI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 16/64 (25%)
PTZ00169 5..293 CDD:240302 79/273 (29%)
Mito_carr 101..200 CDD:278578 27/101 (27%)
Mito_carr 206..301 CDD:278578 31/88 (35%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 72/251 (29%)
Mito_carr 32..129 CDD:278578 18/72 (25%)
Mito_carr 138..233 CDD:278578 25/95 (26%)
Mito_carr 246..331 CDD:278578 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.