DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Rim2

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:391 Identity:74/391 - (18%)
Similarity:131/391 - (33%) Gaps:130/391 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSD----FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVE-----PYKG---------- 48
            |:|    .:.||.|.......|.|:||:|||:|............|     |..|          
  Fly     5 TADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQ 69

  Fly    49 -----------------------------------------IVNAFITVAKNDGITGLQKGLAP- 71
                                                     ||.....:.:|:|...|.|||.| 
  Fly    70 RRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPN 134

  Fly    72 --------ALYFQFIINSFRLSIYSEAMERRWMHNRKGEV---SYGMGLLWGAIGGVVGCYFSSP 125
                    |:||         ..||:.....   |..|.|   |..:.::..|..|.|....::|
  Fly   135 LVGVAPSRAIYF---------CTYSQTKNTL---NSLGFVERDSPLVHIMSAASAGFVSSTATNP 187

  Fly   126 FFLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATF 190
            .:.:||::|.....::.:       ::...:.::|::.||...::|..|:.             |
  Fly   188 IWFVKTRMQLDYNSKVQM-------TVRQCIERVYAQGGVAAFYKGITASY-------------F 232

  Fly   191 G--KTKALLVQYDLV-----------------TQPTLNSFSAGLIAGSIMSVAITPPDVITTRLY 236
            |  :|....|.|:.:                 ::..|....||.::.:|.|....|.:|..|||.
  Fly   233 GICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLR 297

  Fly   237 NQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKYS 301
            .:|..       |..:......:.:.||..|:|:|.....:|..|::.:::..::.:|.|.|:..
  Fly   298 EEGNK-------YNSFWQTLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVVYVLTRRF 355

  Fly   302 N 302
            |
  Fly   356 N 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 27/151 (18%)
PTZ00169 5..293 CDD:240302 69/378 (18%)
Mito_carr 101..200 CDD:278578 19/103 (18%)
Mito_carr 206..301 CDD:278578 22/94 (23%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 28/156 (18%)
Mito_carr 163..253 CDD:278578 18/109 (17%)
Mito_carr 268..355 CDD:278578 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.