DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Ucp4A

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:294 Identity:99/294 - (33%)
Similarity:155/294 - (52%) Gaps:12/294 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAAR--GTYVEPYKGIVNAFITVAKNDGITGLQKG 68
            :::..:|:..|...|.|:::.|||:|:|||.||.  |.....|:|:|.....:|:.:|...|.:|
  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108

  Fly    69 LAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQL 133
            :.||||...:.:..|:..| :.|.:.:..|....:......|.|...|.|..:.:||..|:|.|:
  Fly   109 VTPALYRHVVYSGVRICSY-DLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQI 172

  Fly   134 QSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLV 198
            |.:..:::.......| |...|.|||..|.|::|||:||:..:.||||.:...:.|:...|.|::
  Fly   173 QMEGRRRLMGEPPRVH-SAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIM 236

  Fly   199 QY----DLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKI 259
            ..    |..|...|.|..||.:| :||.   ||.||:.||:.||..|..||||||||.:||..:.
  Fly   237 NRLQMPDCHTVHVLASVCAGFVA-AIMG---TPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQT 297

  Fly   260 LRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            :..||...:||||...::|:||.|....|.|:::
  Fly   298 VSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 26/82 (32%)
PTZ00169 5..293 CDD:240302 99/292 (34%)
Mito_carr 101..200 CDD:278578 30/98 (31%)
Mito_carr 206..301 CDD:278578 38/88 (43%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 99/294 (34%)
Mito_carr 39..138 CDD:278578 28/94 (30%)
Mito_carr 142..239 CDD:278578 30/97 (31%)
Mito_carr 248..336 CDD:278578 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441280
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.