DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and sesB

DIOPT Version :10

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:97 Identity:22/97 - (22%)
Similarity:37/97 - (38%) Gaps:22/97 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   968 DVFTLAYSTDFGDGDVYSVSDTAMLLQAVDPIQLLHDSNSAEPLDEIALSDYGSISDQGFTPSRQ 1032
            |:|     .:.|:|:|    |....:|.:....:..|.|:..   :.|...|....| ||..:.:
  Fly    60 DIF-----DEDGNGEV----DFREFIQGISQFSVKGDKNTKL---KFAFRIYDMDRD-GFISNGE 111

  Fly  1033 IQAVL---------DSPLPEGLAEFSALHGKD 1055
            :..||         ||.|.:.:.:....|.||
  Fly   112 LFQVLKMMVGNNLKDSQLQQIVDKTILFHDKD 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 PTZ00169 5..293 CDD:240302
sesBNP_727448.1 PTZ00169 23..312 CDD:240302 22/97 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.