DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and CG1628

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:134/304 - (44%) Gaps:43/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGI-TGLQKG 68
            ||:.|.|......:.:.|::.:|.::|         |:.|.|:|:::.|::..:.||: .||..|
  Fly   172 DFLAGSLGGAAQVYVSQPLDTVKVKLQ---------TFPEAYRGMLDCFLSTYRKDGVLRGLYAG 227

  Fly    69 LAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYG-MGLLWGAIGGVVGCYFSS----PFFL 128
            ..||::.....||...:.|...  ::::....|:.:.| :..:..|..|.:...||:    |..|
  Fly   228 SVPAVFANVAENSVLFAAYGGC--QKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTEL 290

  Fly   129 IKTQLQSQAAKQIAVGYQHAH-----TSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIA 188
            ||.:|  ||.:::....:.||     |..| ..|.|:...|:||.:||..:...|...|......
  Fly   291 IKCKL--QALREMKNFVEPAHPQDIRTPWT-LTRYIWRTEGIRGFYRGLSSTFLREMPGYFFFFG 352

  Fly   189 TFGKTKALLVQYDLVTQP--TLNSFSAGLIAGSIMSVAITPPDVITTRL----YNQGVDAEGRGL 247
            ::..|:.||.:.|.....  .|.:..||.|.|..:..:..|.|||.:|:    .|:.:.|.|   
  Fly   353 SYEGTRELLRRDDQSKDDIGPLRTMIAGAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVG--- 414

  Fly   248 LYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFD 291
                     ..|:|.|||..:|:|...:.||..|.:..:.:.::
  Fly   415 ---------ADIVRREGVLALYRGLLPSVLRTIPATATLFVVYE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 21/82 (26%)
PTZ00169 5..293 CDD:240302 75/304 (25%)
Mito_carr 101..200 CDD:278578 29/108 (27%)
Mito_carr 206..301 CDD:278578 23/92 (25%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 75/304 (25%)
Mito_carr 170..252 CDD:278578 22/90 (24%)
Mito_carr 263..364 CDD:278578 28/103 (27%)
Mito_carr 369..455 CDD:278578 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.