DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Slc25a10

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:297 Identity:80/297 - (26%)
Similarity:137/297 - (46%) Gaps:34/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG 68
            |.:..|||||.||...|:|::::|..:|.|.|:..|.|      |:.   :.|.:.||...|..|
Mouse     7 SRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMT------GMA---LQVVRTDGFLALYNG 62

  Fly    69 LAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQL 133
            |:.:|..|...:..|.:|| |.|......:.:|.:.:...:|.|.|.|:.|.:..:|..|:..::
Mouse    63 LSASLCRQMTYSLTRFAIY-ETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRM 126

  Fly   134 Q-------SQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFG 191
            |       ||..     .|.||    .|.|.::.....:|.|:.|:..|..|.||.:..|::.:.
Mouse   127 QNDMKLPPSQRR-----NYSHA----LDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYD 182

  Fly   192 KTKALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCF 256
            :.|.|::....::......|.:..|||...:....|.||:.|||.|    ::|.   |:|...|.
Mouse   183 QAKQLVLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMN----SKGE---YQGVFHCA 240

  Fly   257 VKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            ::..:. |....:||.:...:|:.||:.|..:|.::|
Mouse   241 METAKL-GPQAFFKGLFPAGIRLIPHTVLTFMFLEQL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 26/82 (32%)
PTZ00169 5..293 CDD:240302 78/294 (27%)
Mito_carr 101..200 CDD:278578 26/105 (25%)
Mito_carr 206..301 CDD:278578 24/88 (27%)
Slc25a10NP_038798.2 Solcar 1 7..87 30/89 (34%)
Mito_carr 12..92 CDD:278578 29/89 (33%)
Mito_carr 94..189 CDD:278578 26/103 (25%)
Solcar 2 100..187 24/95 (25%)
Solcar 3 196..279 24/89 (27%)
Mito_carr 197..283 CDD:278578 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.