DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and ucp-4

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:310 Identity:89/310 - (28%)
Similarity:150/310 - (48%) Gaps:34/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATSDFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGL 65
            :||..| |...|::.|...|.|:::.|||:|:......:|       |:|.....:.:.:|...|
 Worm    23 IATKYF-LSCTAALVAETVTYPLDITKTRLQIARNKFTKG-------GMVQVTYDIIRREGAMAL 79

  Fly    66 QKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGM--GLLWGAIGGVVGCYFSSPFFL 128
            ..|:|||:...:|....|:..|.:.  |....|::.|.|:.:  .:|.||..|::..:.:||..|
 Worm    80 WTGVAPAITRHYIYTGIRMGAYEQI--RLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDL 142

  Fly   129 IKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKT 193
            :|.|:|.:..:::. .....:|..||..|.:|...|..|||.|.:....||||.:.|.|||:...
 Worm   143 VKVQMQMEGLRRLQ-KQPLRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSV 206

  Fly   194 KALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQ---------------GVDAE 243
            |..|:....:....|....|...||...::...|.||:.||:.:|               .||  
 Worm   207 KHGLIDNFELKDNWLTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVD-- 269

  Fly   244 GRGLLYRGWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
                ||:|.:||::||:::||.:.:||||..:|:|:||.|....:.::|:
 Worm   270 ----LYKGVVDCYIKIIKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 21/82 (26%)
PTZ00169 5..293 CDD:240302 86/304 (28%)
Mito_carr 101..200 CDD:278578 32/100 (32%)
Mito_carr 206..301 CDD:278578 31/103 (30%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 89/310 (29%)
Mito_carr 22..111 CDD:278578 25/97 (26%)
Mito_carr 115..214 CDD:278578 31/99 (31%)
Mito_carr <240..318 CDD:278578 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.