DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and misc-1

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_493694.2 Gene:misc-1 / 173414 WormBaseID:WBGene00015186 Length:306 Species:Caenorhabditis elegans


Alignment Length:295 Identity:81/295 - (27%)
Similarity:151/295 - (51%) Gaps:11/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGLA 70
            |..||.|.:|||....|::::|.|:||.|.     |..:.|:..::|..::.||:|:..:..||:
 Worm    13 FAFGGTAGMGATLVVQPLDLVKNRMQLSGT-----TGKKEYRSSMHALTSIMKNEGVFAVYNGLS 72

  Fly    71 PALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQS 135
            ..|..|....:.||..|:..:||  ...:...:|:||..:.|...|.:|.:..:|..:...::..
 Worm    73 AGLLRQATYTTTRLGTYAFLLER--FTEKDKPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTG 135

  Fly   136 QAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQY 200
            ..  ::.|..:..:|.:.:||.:|....||..||||....:.||.:.:.||:||:.:.|..|:..
 Worm   136 DG--RLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLAS 198

  Fly   201 DLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEGV 265
            ..|.......|.|.:|:|...::|..|.|:..||:.:..| .:|:. .|:...|.:.|::::||:
 Worm   199 GKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKV-IDGKP-EYKNAFDVWGKVIKNEGI 261

  Fly   266 YGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKY 300
            :.::|||...|:|:.||:.|..:..:::.|...:|
 Worm   262 FALWKGFTPYYMRLGPHTVLTFIILEQMNAAYFQY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 25/80 (31%)
PTZ00169 5..293 CDD:240302 79/286 (28%)
Mito_carr 101..200 CDD:278578 26/98 (27%)
Mito_carr 206..301 CDD:278578 26/95 (27%)
misc-1NP_493694.2 Mito_carr 7..99 CDD:278578 28/92 (30%)
Mito_carr 101..196 CDD:278578 25/96 (26%)
Mito_carr 202..296 CDD:278578 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.