DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and Slc25a10

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:293 Identity:80/293 - (27%)
Similarity:139/293 - (47%) Gaps:24/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSDFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQK 67
            ||.:..|||||.||...|:|::::|..:|.|.|:..|.|      |:.   :.|.:.||...|..
  Rat     6 TSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMT------GMA---LQVVRTDGFLALYN 61

  Fly    68 GLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQ 132
            ||:.:|..|...:..|.:|| |.|......:.:|.:.:...:|.|.|.|:.|.:..:|..|:..:
  Rat    62 GLSASLCRQMTYSLTRFAIY-ETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVR 125

  Fly   133 LQSQAAKQIAV--GYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKA 195
            :|:.....::.  .|.||    .|.|.::....|::.|:.|:..|..|.||.:..|::.:.:.|.
  Rat   126 MQNDMKLPLSQRRNYSHA----LDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQ 186

  Fly   196 LLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKIL 260
            |::....::......|.:..|||...:....|.||:.|||.|    ::|.   |:|...|.|:..
  Rat   187 LVLSTGYLSDNIFTHFLSSFIAGGCATFLCQPLDVLKTRLMN----SKGE---YQGVFHCAVETA 244

  Fly   261 RSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            :. |....:||.....:|:.||:.|..:|.::|
  Rat   245 KL-GPQAFFKGLVPAGVRLVPHTVLTFMFLEQL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 26/82 (32%)
PTZ00169 5..293 CDD:240302 77/289 (27%)
Mito_carr 101..200 CDD:278578 24/100 (24%)
Mito_carr 206..301 CDD:278578 25/88 (28%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 29/89 (33%)
Mito_carr 94..189 CDD:395101 24/98 (24%)
Mito_carr 197..283 CDD:395101 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.