DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and SLC25A10

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:184 Identity:51/184 - (27%)
Similarity:91/184 - (49%) Gaps:12/184 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG 68
            |.:..|||||.||...|:|::::|..:|.|.|:..|.|      |:.   :.|.:.|||..|..|
Human     8 SRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMT------GMA---LRVVRTDGILALYSG 63

  Fly    69 LAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQL 133
            |:.:|..|...:..|.:|| |.:..|.....:|.:.:...:|.|::.|:.|.:..:|..|:..::
Human    64 LSASLCRQMTYSLTRFAIY-ETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRM 127

  Fly   134 QSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQI 187
            |:..  ::..|.:..:....|.|.::....|:|.|:.|:..|..|.||.:..|:
Human   128 QNDV--KLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 27/82 (33%)
PTZ00169 5..293 CDD:240302 50/183 (27%)
Mito_carr 101..200 CDD:278578 20/87 (23%)
Mito_carr 206..301 CDD:278578
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 30/89 (34%)
Mito_carr 95..179 CDD:278578 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.