DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8323 and slc25a34

DIOPT Version :9

Sequence 1:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001135591.1 Gene:slc25a34 / 100216146 XenbaseID:XB-GENE-5994554 Length:301 Species:Xenopus tropicalis


Alignment Length:298 Identity:130/298 - (43%)
Similarity:182/298 - (61%) Gaps:23/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKGL 69
            |||||..|...|..||||:||:|||:||||||.:||||...|:|::.|.:.|.:.||:.||||||
 Frog     8 DFVLGASACCMACVFTNPLEVVKTRLQLQGELRSRGTYTRHYRGVLQAMVAVGQADGLRGLQKGL 72

  Fly    70 APALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGL--------LWGAIGGVVGCYFSSPF 126
            ...|.:|.::|..|..:||.|              .|:||        ..||:.|..|.:..||.
 Frog    73 TAGLLYQAMMNGVRFYLYSHA--------------EGIGLTEQPGGNIAAGAVAGATGAFVGSPA 123

  Fly   127 FLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFG 191
            :|:||.||:|....||||:||.|.|::.|...||.:.|:.|||||...|:||..:||..|:|||.
 Frog   124 YLVKTHLQAQTVAAIAVGHQHNHQSVSSAFETIYKKQGILGLWRGVNGAVPRVMVGSAVQLATFA 188

  Fly   192 KTKALLVQYDLVTQPT-LNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDC 255
            ..|..:.:.......: |.:.:.|:|:...:::|:||.||::||||||.||:.|:|.||||:|||
 Frog   189 NAKEWVKKQQWFPHDSWLVALTGGMISSIGVAIAMTPFDVVSTRLYNQPVDSSGKGRLYRGFLDC 253

  Fly   256 FVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDEL 293
            .:||:..|||..:|||....|:|:.||:.|.|||::||
 Frog   254 ILKIIHKEGVLALYKGIVPAYIRLGPHTILSLLFWEEL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 42/81 (52%)
PTZ00169 5..293 CDD:240302 128/296 (43%)
Mito_carr 101..200 CDD:278578 42/106 (40%)
Mito_carr 206..301 CDD:278578 43/89 (48%)
slc25a34NP_001135591.1 Mito_carr 3..90 CDD:278578 42/81 (52%)
Mito_carr <118..196 CDD:278578 35/77 (45%)
Mito_carr 202..294 CDD:278578 43/90 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7192
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68806
Inparanoid 1 1.050 163 1.000 Inparanoid score I4090
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 1 1.000 - - FOG0001815
OrthoInspector 1 1.000 - - otm48081
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.