DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pea and pnp

DIOPT Version :10

Sequence 1:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster
Sequence 2:NP_417633.4 Gene:pnp / 947672 ECOCYCID:EG10743 Length:711 Species:Escherichia coli


Alignment Length:101 Identity:41/101 - (40%)
Similarity:60/101 - (59%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 MTDDPEAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVK 342
            :|.:.|.|::|:||:..||.||.||.:.|.:   ||||||||: |:.||..||:.:...|.|.||
E. coli   615 ITAEIEVGRVYTGKVTRIVDFGAFVAIGGGK---EGLVHISQI-ADKRVEKVTDYLQMGQEVPVK 675

  Fly   343 VMSITGQ-KVSLSMKEVDQDSGKDLNPLSHAPEDDE 377
            |:.:..| ::.||:||..:.|.....|.:.|.|..|
E. coli   676 VLEVDRQGRIRLSIKEATEQSQPAAAPEAPAAEQGE 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peaNP_610928.1 GH2-like_DHX8 7..74 CDD:409668
S1_DHX8_helicase 285..363 CDD:240189 34/78 (44%)
HrpA 578..>1203 CDD:441249
pnpNP_417633.4 PRK11824 1..692 CDD:236995 35/80 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.