DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pea and AT2G35920

DIOPT Version :10

Sequence 1:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster
Sequence 2:NP_001323636.1 Gene:AT2G35920 / 818165 AraportID:AT2G35920 Length:1027 Species:Arabidopsis thaliana


Alignment Length:39 Identity:8/39 - (20%)
Similarity:19/39 - (48%) Gaps:4/39 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   727 KILGPLIRLEHVCWNP----LTMDALVELENEKWYRTAA 761
            ::|.|::.:.:.||.|    :..:|:.:....:|....|
plant   303 RVLVPVVIVFYTCWAPCMITILYNAITQDRVPEWVEFVA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peaNP_610928.1 GH2-like_DHX8 7..74 CDD:409668
S1_DHX8_helicase 285..363 CDD:240189
HrpA 578..>1203 CDD:441249 8/39 (21%)
AT2G35920NP_001323636.1 HrpA 252..>927 CDD:441249 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.