DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pea and T07D4.5

DIOPT Version :9

Sequence 1:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster
Sequence 2:NP_001122634.1 Gene:T07D4.5 / 6418633 WormBaseID:WBGene00045407 Length:142 Species:Caenorhabditis elegans


Alignment Length:109 Identity:25/109 - (22%)
Similarity:46/109 - (42%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1128 ICSGFFRNAAKKDPQEGYRTLVD--SQVVYI-----HPSSALFNRQPEWVIYHELVQTTKEYMRE 1185
            :.:|...|.| |.|.:..:.|.|  |:::|:     |......|...|...:.|:.:..||    
 Worm     5 LSTGMALNNA-KTPHDHQKELRDKTSEIIYLSTKLNHAKETCVNLDNERQKFREVSRKIKE---- 64

  Fly  1186 VTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQR-LEPLYNKYEE 1228
             ..|||.|:.. ...|.:.|....|:..:|:.: :|.:..:.:|
 Worm    65 -KDIDPVWIYN-GTCFLQTSQANSLNILEKDTKTVEEVRGQIQE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peaNP_610928.1 S1_DHX8_helicase 285..363 CDD:240189
HrpA 573..1221 CDD:224557 23/100 (23%)
T07D4.5NP_001122634.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.