DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pea and Zcchc17

DIOPT Version :9

Sequence 1:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster
Sequence 2:NP_694800.1 Gene:Zcchc17 / 619605 MGIID:1919955 Length:241 Species:Mus musculus


Alignment Length:266 Identity:57/266 - (21%)
Similarity:117/266 - (43%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 MTDDPEAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVK 342
            |.:.|....|:.|::|.:..:|.|:::.|.||  :||||.:.: :..||...:|:|.....|.||
Mouse     9 MENLPALYTIFQGEVAMVTDYGAFIKIPGCRK--QGLVHRTHM-SSCRVDKPSEIVDVGDKVWVK 70

  Fly   343 V----MSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDESLRDRNPDGPFSSSTSMLNLQGNGME 403
            :    |.....|||||||.|:|.:||||:|                               |.:.
Mouse    71 LIGREMKNDRIKVSLSMKVVNQGTGKDLDP-------------------------------NNVV 104

  Fly   404 GDEHESRKRVTRISSPERWEIKQMISS-----GVLDRSEMPDFDEETG----LLPKDEDDEADIE 459
            .::.|.|:|..:..:.::..::.::::     |.........|.:..|    |:|::|:::.:.:
Mouse   105 IEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPEEEEEKEEAK 169

  Fly   460 IEIVEEEPPFLSGHGRALHDLSPV--RIVKNPD----------GSLAQAAMMQSALSKERREQKM 512
            .|.:|:..|..:...:...:....  |..|:.|          |..|:.:...|..:|:::::|.
Mouse   170 AEGLEKPDPTKNSSRKRKKEKKKKKHRDRKSSDCDSSDSESDTGKKARHSSKDSKATKKKKKKKK 234

  Fly   513 LQREQE 518
            .:::.:
Mouse   235 HKKKHK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peaNP_610928.1 S1_DHX8_helicase 285..363 CDD:240189 29/81 (36%)
HrpA 573..1221 CDD:224557
Zcchc17NP_694800.1 S1_pNO40 13..86 CDD:240191 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..241 12/81 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.