Sequence 1: | NP_610928.1 | Gene: | pea / 36561 | FlyBaseID: | FBgn0086895 | Length: | 1242 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001269495.1 | Gene: | ZCCHC17 / 51538 | HGNCID: | 30246 | Length: | 263 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 65/225 - (28%) |
---|---|---|---|
Similarity: | 96/225 - (42%) | Gaps: | 49/225 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 265 RDCSEKMPPPSAAMTDDP--EAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVT 327
Fly 328 DVTEVVTRNQTVKVKV----MSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDESLRDRNPD--G 386
Fly 387 PFSSSTSMLN-----------------LQGNGME----GDEHESRKRV----------TRISSPE 420
Fly 421 RWEIKQMISSGVLDR----SEMPDFDEETG 446 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pea | NP_610928.1 | S1_DHX8_helicase | 285..363 | CDD:240189 | 28/81 (35%) |
HrpA | 573..1221 | CDD:224557 | |||
ZCCHC17 | NP_001269495.1 | S1_pNO40 | 45..108 | CDD:240191 | 21/65 (32%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1643 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |