DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pea and ZCCHC17

DIOPT Version :9

Sequence 1:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster
Sequence 2:NP_001269495.1 Gene:ZCCHC17 / 51538 HGNCID:30246 Length:263 Species:Homo sapiens


Alignment Length:225 Identity:65/225 - (28%)
Similarity:96/225 - (42%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 RDCSEKMPPPSAAMTDDP--EAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVT 327
            |.||..: |.||...|..  |||......:|.:..:|.|:::.|.||  :||||.:.: :..||.
Human    17 RLCSLNL-PFSAEGADSKGWEAGPESPAVVAMVTDYGAFIKIPGCRK--QGLVHRTHM-SSCRVD 77

  Fly   328 DVTEVVTRNQTVKVKV----MSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDESLRDRNPD--G 386
            ..:|:|.....|.||:    |.....|||||||.|:|.:||||:|.:...|.:|..|....|  |
Human    78 KPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTG 142

  Fly   387 PFSSSTSMLN-----------------LQGNGME----GDEHESRKRV----------TRISSPE 420
            ...:..::||                 :|..|.:    .||.|.::..          ||  :|.
Human   143 QKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTR--NPS 205

  Fly   421 RWEIKQMISSGVLDR----SEMPDFDEETG 446
            |...|:.......||    |:..|.:.:||
Human   206 RKRKKEKKKKKHRDRKSSDSDSSDSESDTG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peaNP_610928.1 S1_DHX8_helicase 285..363 CDD:240189 28/81 (35%)
HrpA 573..1221 CDD:224557
ZCCHC17NP_001269495.1 S1_pNO40 45..108 CDD:240191 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.