DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pea and Zcchc17

DIOPT Version :9

Sequence 1:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster
Sequence 2:NP_001102737.1 Gene:Zcchc17 / 500555 RGDID:1565267 Length:241 Species:Rattus norvegicus


Alignment Length:298 Identity:62/298 - (20%)
Similarity:123/298 - (41%) Gaps:84/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 MTDDPEAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVK 342
            |.:.|....|:.|::|.:..:|.|:::.|.||  :||||.:.: :..||...:|:|.....|.||
  Rat     9 MENLPALYTIFQGEVAMVTDYGAFIKIPGCRK--QGLVHRTHM-SSCRVDKPSEIVDVGDKVWVK 70

  Fly   343 V----MSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDESLRDRNPDGPFSSSTSMLNLQGNGME 403
            :    |.....|||||||.|:|.:||||:|                               |.:.
  Rat    71 LIGREMKNDRIKVSLSMKVVNQGTGKDLDP-------------------------------NNVI 104

  Fly   404 GDEHESRKRVTRISSPERWEIKQMISS-----GVLDRSEMPDFDEETG----LLPKDEDDEADIE 459
            .::.|.|:|..:..:.::..::.::::     |.........|.:..|    |:|::|:::.:.:
  Rat   105 IEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLVPEEEEEKEEAK 169

  Fly   460 IEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQREQEIEAMPT 524
            .|.:|:..|                 .||.              |::|:::|..::.::.::...
  Rat   170 AEGLEKPDP-----------------TKNS--------------SRKRKKEKKKKKHRDRKSSDC 203

  Fly   525 SLNKNWIDPLPEDESRSLAANMRGMAAAPPEVPEWKKH 562
            .      .|..|.::...|.:....:.||.:..:.|||
  Rat   204 D------SPDSESDTGKKARHTAKDSKAPKKKKKKKKH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peaNP_610928.1 S1_DHX8_helicase 285..363 CDD:240189 29/81 (36%)
HrpA 573..1221 CDD:224557
Zcchc17NP_001102737.1 S1_pNO40 13..86 CDD:240191 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.