DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pea and sirt3.2

DIOPT Version :10

Sequence 1:NP_610928.1 Gene:pea / 36561 FlyBaseID:FBgn0086895 Length:1242 Species:Drosophila melanogaster
Sequence 2:NP_001120529.1 Gene:sirt3.2 / 100145681 XenbaseID:XB-GENE-5721494 Length:401 Species:Xenopus tropicalis


Alignment Length:118 Identity:22/118 - (18%)
Similarity:41/118 - (34%) Gaps:44/118 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 DRRHKSSSSRDHHERRRRSRSRSTERRDRRDRSRDCSEKMPPPSAAMTDDPEAGKIYSGKIANIV 296
            |.:|.:    ::|.|:|.:...|...|      :.|..|...|.:|:..:          |:.|.
 Frog    62 DLKHPT----EYHSRKRENGRLSGVIR------QSCLRKRQLPKSALAKN----------ISAIK 106

  Fly   297 P-FGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMSITG 348
            | .||                       ..:.|:.:::|:|....:.||:..|
 Frog   107 PNIGC-----------------------NNLEDILDLITKNCCTNIIVMAGAG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
peaNP_610928.1 GH2-like_DHX8 7..74 CDD:409668
S1_DHX8_helicase 285..363 CDD:240189 11/65 (17%)
HrpA 578..>1203 CDD:441249
sirt3.2NP_001120529.1 SIRT1 127..360 CDD:238699 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.