DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd1 and AT5G41850

DIOPT Version :9

Sequence 1:NP_001260963.1 Gene:Rcd1 / 36560 FlyBaseID:FBgn0033897 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_199000.1 Gene:AT5G41850 / 834190 AraportID:AT5G41850 Length:224 Species:Arabidopsis thaliana


Alignment Length:193 Identity:44/193 - (22%)
Similarity:99/193 - (51%) Gaps:12/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 SDRMQKWYQALSTITQVVQI---SLPNTNNRIGNQNLDHVAETIVSITRVKINELRTENPSRGII 436
            ||.|.:|.:.|....:.|::   ..|...:  |.:.:...||.::......:.|...:.|...:|
plant    34 SDWMIRWKEMLKKTLEAVEVVTFDYPYLAD--GKKRVAPKAEKLIEFHLNVVKETAAKFPGHPLI 96

  Fly   437 LVGFNAGAALALQV-ALSE--SVACVVCMGFAYNTIRGPRGT-PDDRMLDIKAPILFVIGQNSAR 497
            |||.:.|:.::..| |::|  :|:.|:|:|:   .::|.:|. .|:.:|::..|::||.|.....
plant    97 LVGKSMGSRVSCMVSAVNEDVTVSAVICLGY---PLKGAKGAIRDETLLEMGVPVMFVQGSKDPM 158

  Fly   498 TSQEEMEGLRERMQSESSLVVVGSADDALRVPKSKRRIEGVTQSMVDYMVVEEIFEFVNRTLS 560
            ....::|.:..:|::.:.:.|:...|.:.::.|.....:.:||..|:.:.::.|..||:::|:
plant   159 CPLNKLEAVCNKMKAVTEVHVIDGGDHSFKIGKKHLETKELTQEEVEDVAMKAIAAFVSKSLA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd1NP_001260963.1 None
AT5G41850NP_199000.1 Abhydrolase 17..188 CDD:419691 36/158 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3319
orthoMCL 1 0.900 - - OOG6_105996
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.