DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd1 and Tex30

DIOPT Version :9

Sequence 1:NP_001260963.1 Gene:Rcd1 / 36560 FlyBaseID:FBgn0033897 Length:1131 Species:Drosophila melanogaster
Sequence 2:NP_001382563.1 Gene:Tex30 / 301381 RGDID:1309095 Length:227 Species:Rattus norvegicus


Alignment Length:162 Identity:35/162 - (21%)
Similarity:67/162 - (41%) Gaps:32/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 TNNRIGNQNLDH---VAETIVS---------------ITRVK-----INELRT--ENPSRGIILV 438
            |:...|:.||.|   :|..:.|               :.|:|     :|.|:|  |....|:.|.
  Rat    35 THGASGDMNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKAVLNYLKTSGEYKLAGVFLG 99

  Fly   439 GFNAGAALALQVA-------LSESVACVVCMGFAYNTIRGPRGTPDDRMLDIKAPILFVIGQNSA 496
            |.:.|:..|..|.       ..:.|..::|:.:..:..:......|:.:..||.|:|||.|....
  Rat   100 GRSMGSRAAASVMCHTELDDADDFVRGLICISYPLHHPKQQHKLRDEDLFRIKDPVLFVSGSADE 164

  Fly   497 RTSQEEMEGLRERMQSESSLVVVGSADDALRV 528
            ...:..:|.:.::||:.|.:..:..|:.::.|
  Rat   165 MCEKNLLEKVAQKMQAPSKIHWIEKANHSMAV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd1NP_001260963.1 None
Tex30NP_001382563.1 Abhydrolase 32..219 CDD:419691 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.