DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18371 and ACYP1

DIOPT Version :9

Sequence 1:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001289546.1 Gene:ACYP1 / 97 HGNCID:179 Length:129 Species:Homo sapiens


Alignment Length:97 Identity:41/97 - (42%)
Similarity:57/97 - (58%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPAEQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFW 66
            |.....:.|..:|:||:||||..||.|:.......:.|||.|||.|||:|||:|.:.||..::.|
Human    31 MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEW 95

  Fly    67 LLNIGSPRSIIERAEFTPTKEITSHNFSRFSI 98
            |...|||:|.|::|.|...|.|...::|.|.|
Human    96 LETRGSPKSHIDKANFNNEKVILKLDYSDFQI 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18371NP_610923.1 Acylphosphatase 10..99 CDD:279097 40/89 (45%)
ACYP1NP_001289546.1 Acylphosphatase 40..127 CDD:376373 38/86 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm8661
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.