DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18371 and Acyp2

DIOPT Version :9

Sequence 1:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_083620.1 Gene:Acyp2 / 75572 MGIID:1922822 Length:106 Species:Mus musculus


Alignment Length:95 Identity:45/95 - (47%)
Similarity:60/95 - (63%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFWLLNI 70
            |.:.|..:|:||.|||||.|..|...|....:.|||.||.:|||.||::|...||:.:|.||..:
Mouse    12 ELLKSVDYEVFGTVQGVCFRMYTEGEAKKRGLVGWVKNTSKGTVTGQVQGPEEKVDAMKSWLSKV 76

  Fly    71 GSPRSIIERAEFTPTKEITSHNFSRFSIRY 100
            |||.|.|:||:|:..|.|:...:|.|||||
Mouse    77 GSPSSRIDRADFSNEKTISKLEYSDFSIRY 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18371NP_610923.1 Acylphosphatase 10..99 CDD:279097 41/88 (47%)
Acyp2NP_083620.1 Acylphosphatase 13..105 CDD:279097 41/91 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5759
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm42435
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.770

Return to query results.
Submit another query.